PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D05G3001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 391aa    MW: 44768 Da    PI: 6.7383
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D05G3001genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix86.43.4e-2782163286
     trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  W ++e++ Li +rrem+  ++++k++k+lWe++s+kmre+gf rsp++C++kw+nl k++kk k+++++     s +++y++++e
  Gh_D05G3001  82 WVQDETRSLIGFRREMDGLFNTSKSNKHLWEQISAKMREKGFDRSPTMCTDKWRNLLKEFKKAKHQDRGS---GSAKMSYYKEIE 163
                  ********************************************************************84...556899***997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-472143IPR009057Homeodomain-like
PROSITE profilePS500908.29374138IPR017877Myb-like domain
SMARTSM007170.007778140IPR001005SANT/Myb domain
CDDcd122034.61E-2980145No hitNo description
PfamPF138376.0E-2181165No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MYLSEKPRPI DLYKEEGPAA APRDMIIEVT SNGDLPPHHH HHHPPPPHHH HQHQQQQQQM  60
ILGESSGEDP EVKAPKKRAE TWVQDETRSL IGFRREMDGL FNTSKSNKHL WEQISAKMRE  120
KGFDRSPTMC TDKWRNLLKE FKKAKHQDRG SGSAKMSYYK EIEEILRERT KNSYKSPTPP  180
PKPDSFMHFA DKGFEDAGIS FGPVEASGRP TLNLERRLDH DGHPLAITAA DAVAASGVPP  240
WNWRETPGNG GDCQSYGGRV ITVKYGDYTR RIGIDGTADA IREAIKSAFG LRTKRSFWLE  300
DEDNIVRSFD REMPLGNYTL HLDEGLAIKV CLYDESDHIP VHTEDKIFYT EDDYREYLAR  360
RGYTGLRDID GYRSIDNMDD LRPNAIYRGV S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A5e-5276161186DNA binding protein GT-1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.3070.0boll| ovule| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00004PBMTransfer from 920224Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5272091e-109HQ527209.1 Gossypium herbaceum clone NBRI_D_EYT27PB02D0J5N simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012440641.10.0PREDICTED: trihelix transcription factor GT-1
SwissprotQ9FX530.0TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLA0A0D2UXS50.0A0A0D2UXS5_G
STRINGGLYMA11G37390.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28912768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.10.0Trihelix family protein